Skip to Content

ELISA Recombinant Mouse Myoglobin(Mb)

https://biotrend.labm.com/web/image/product.template/145335/image_1920?unique=c91b609
Quantity: 20µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Cancer Uniprot ID: P04247 Gene Names: Mb Organism: Mus muscµLus (Mouse) AA Sequence: GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG Expression Region: 2-154aa Sequence Info: FµLl Length Source: Mammalian cell Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged MW: 21.9 kDa Alternative Name(s): Relevance: Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles. Reference: "The mouse myoglobin gene. Characterisation and sequence comparison with other mammalian myoglobin genes." Blanchetot A., Price M., Jeffreys A.J. Eur. J. Biochem. 159:469-474(1986) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

585.70 € 585.7 EUR 585.70 €

585.70 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.