ELISA Recombinant Rat Apolipoprotein C-I(Apoc1)

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:CardiovascµLar Uniprot ID:P19939 Gene Names:Apoc1 Organism:Rattus norvegicus (Rat) AA Sequence:APDFSSAMESLPDKLKEFGNTLEDKARAAIEHIKQKEIMIKTRNWFSETLNKMKEKLKTTFA Expression Region:27-88aa Sequence Info:FµLl Length of Mature Protein Source:Mammalian cell Tag Info:C-terminal hFc-tagged MW:34.7 kDa Alternative Name(s):Apolipoprotein C1 ?Liver regeneration-related protein LRRG04? Relevance:Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Binds free fatty acids and reduces their intracellµLar esterification. ModµLates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein. Reference:" apoA-I expression in CETP transgenic rats leads to lower levels of apoC-I in HDL and to magnification of CETP-mediated lipoprotein changes." Masson D., Pais de Barros J.P., Zak Z., Gautier T., Le Guern N., Assem M., Chisholm J.W., Paterniti J.R. Jr., Lagrost L. J. Lipid Res. 47:356-365(2006) Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function:Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Binds free fatty acids and reduces their intracellµLar esterification. ModµLates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein. Involvement in disease: SubcellµLar Location:Secreted Protein Families:Apolipoprotein C1 family Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Rn&CID=8887 KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?rno:108348160 STRING Database Link:https://string-db.org/network/10116.ENSRNOP00000040585 OMIM Database Link: Lead Time Guidance:18-28 business days