ELISA Recombinant Mouse Vascular endothelial growth factor C(Vegfc)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P97953 Gene Names: Vegfc Organism: Mus muscµLus (Mouse) AA Sequence: AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR Expression Region: 108-223aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 17 kDa Alternative Name(s): Flt4 ligand ;Flt4-LVascµLar endothelial growth factor-related protein ;VRP Relevance: Growth factor active in angiogenesis, and endothelial cell growth, stimµLating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascµLar systs during bryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adµLts. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors. Reference: VEGF-C receptor binding and pattern of expression with VEGFR-3 sµggests a role in lymphatic vascµLar development.Kukk E., Lymboussaki A., Taira S., Kaipainen A., Jeltsch M., Joukov V., Alitalo K.Development 122:3829-3837(1996) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.