ELISA Recombinant Arabidopsis thaliana Secretory carrier-associated membrane protein 3(SCAMP3)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:Q9M5P2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MANRYDPNPFAEEEEVNPFANARGVPPASNSRLSPLPPEPVGFDYGRTVDIPLDRAGTQD LKKKEKELQAKEAELKRREQDLKRKEDAAARAGIVIEVKNWPPFFPLIHHDIANEIPVHL QRLQYVTFATYLGLVLCLFWNIIAVTTAWIKGEGVTIWLLALIYFIAGVPGGYVLWYRPL YRAFRTDSALSFGWFFLFYmLHIAFCVFAAVAPPVVFKGKSLAGILPAIDVLSGQAIVGI FYFIGFAFFCLESVVSIWVIQQVYMYFRGSGKQDQMRREAARGALRAAV Protein Names:Recommended name: Secretory carrier-associated membrane protein 3 Short name= AtSC3 Short name= Secretory carrier membrane protein 3 Gene Names:Name:SCAMP3 Synonyms:SC3 Ordered Locus Names:At1g61250 ORF Names:F11P17.4 Expression Region:1-289 Sequence Info:fµLl length protein