ELISA Recombinant Xenopus tropicalis NEDD4 family-interacting protein 1(ndfip1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q4V786 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSEQSSSRYQQLQNEEEPGENPQASTDAPPPYSSIAGESSGLFDYKDELGFPKPPSYNVA TSLPSYDEAERTKAEATIPLVPGRDDDFVARDDFDDADQLRIGNDGIFmLTFFMAFLFNW IGFFLSFCLTSSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFL LFLRGFINYAKVRKMPDNFSTLPRTRVLFIY Protein Names:Recommended name: NEDD4 family-interacting protein 1 Gene Names:Name:ndfip1 Expression Region:1-211 Sequence Info:fµLl length protein