Skip to Content

ELISA Recombinant Anser caerulescens Cytochrome b(MT-CYB)

https://biotrend.labm.com/web/image/product.template/116245/image_1920?unique=7f7b80c
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Anser caerµLescens (Snow goose) (Chen caerµLescens) Uniprot NO.:Q31652 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAPNIRKSHPLLKMINNSLIDLPAPSNISAWWNFGSLLAICLVTQILTGLLLAMHYTADT SLAFSSVAHTCRDV Protein Names:Recommended name: Cytochrome b Alternative name(s): Complex III subunit 3 Complex III subunit III Cytochrome b-c1 complex subunit 3 Ubiquinol-cytochrome-c reductase complex cytochrome b subunit Gene Names:Name:MT-CYB Synonyms:COB, CYTB, MTCYB Expression Region:1-74 Sequence Info:fµLl length protein

1,413.00 € 1413.0 EUR 1,413.00 €

1,413.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out  !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.