Skip to Content

ELISA Recombinant V-type proton ATPase subunit S1(ATP6AP1)

https://biotrend.labm.com/web/image/product.template/140622/image_1920?unique=bf930ac
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q15904 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:EQQVPLVLWSSDRDLWAPAADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKLSIED FTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAVSTLTTYLQEKLGASPLHVDL ATLRELKLNASLPALLLIRLPYTASSGLMAPREVLTGNDEVIGQVLSTLKSEDVPYTAAL TAVRPSRVARDVAVVAGGLGRQLLQKQPVSPVIHPPVSYNDTAPRILFWAQNFSVAYKDQ WEDLTPLTFGVQELNLTGSFWNDSFARLSLTYERLFGTTVTFKFILANRLYPVSARHWFT MERLEVHSNGSVAYFNASQVTGPSIYSFHCEYVSSLSKKGSLLVARTQPSPWQMmLQDFQ IQAFNVMGEQFSYASDCASFFSPGIWMGLLTSLFmLFIFTYGLHMILSLKTMDRFDDHKG PTISLTQIV Protein Names:Recommended name: V-type proton ATPase subunit S1 Short name= V-ATPase subunit S1 Alternative name(s): Protein XAP-3 V-ATPase Ac45 subunit V-ATPase S1 accessory protein Vacuolar proton pump subunit S1 Gene Names:Name:ATP6AP1 Synonyms:ATP6IP1, ATP6S1, VATPS1, XAP3 Expression Region:42-470 Sequence Info:fµLl length protein

1,788.00 € 1788.0 EUR 1,788.00 €

1,788.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.