ELISA Recombinant Enterobacteria phage lambda Holin(S)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Enterobacteria phage lambda (Bacteriophage lambda) Uniprot NO.:P03705 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKMPEKHDLLAAILAAKEQGIGAILAFAMAYLRGRYNGGAFTKTVIDATMCAIIAWFIRD LLDFAGLSSNLAYITSVFIGYIGTDSIGSLIKRFAAKKAGVEDGRNQ Protein Names:Recommended name: Holin Alternative name(s): gpS protein Including the following 2 domains: Lysis protein S Lysis inhibitor Gene Names:Name:S Expression Region:1-107 Sequence Info:fµLl length protein