ELISA Recombinant Geobacillus stearothermophilus Protein translocase subunit SecY(secY)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Geobacillus stearothermophilus (Bacillus stearothermophilus) Uniprot NO.:P28620 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:NPEQMAENLKKQGGYIPGIRPGKNTQEYVTRILYRLTLVGSVFLAVIAVLPVFFVNVANL PPSAKIGGTSLLIVVGVALETMKQLESQLVKRHYRGFIK Protein Names:Recommended name: Protein translocase subunit SecY Gene Names:Name:secY Expression Region:1-99 Sequence Info:fµLl length protein