ELISA Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: Q9I840
Gene Names: N/A
Organism: Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma)
AA Sequence: DCPSGWSSYEGHCYKPFNEPKNWADAERFCKLQPKHSHLVSFQSAEEADFVVKLTRPRLKANLVWMGLSNIWHGCNWQWSDGARLNYKDWQEQSECLAFRGVHTEWLNMDCSSTCSFVCKFKA
Expression Region: 24-146aa
Sequence Info: FµLl Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 16.4 kDa
Alternative Name(s): Aggretin beta chain Rhodoaggretin subunit beta
Relevance: Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2). Binding leads to tyrosine phosphorylation in the Cytoplasmic domain tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLCgamma2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial.
Reference: "MolecµLar cloning and sequence analysis of aggretin, a collagen-like platelet aggregation inducer."Chung C.-H., Au L.-C., Huang T.-F.Biochem. Biophys. Res. Commun. 263:723-727(1999)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.