ELISA Recombinant Trichoderma reesei Hydrophobin-2(hfb2)

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170725 Research areas: others Target / Protein: hfb2 Biologically active: Not Tested Expression system: Yeast Species of origin: Hypocrea jecorina (Trichoderma reesei) Delivery time: 3-7 business days Uniprot ID: P79073 AA Sequence: AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF Tag info: N-terminal 6xHis-sumostar-tagged Expression Region: 16-86aa Protein length: FµLl Length of Mature Protein MW: 23.2 kDa Alternative Name(s): Hydrophobin II Relevance: Responsible for spore hydrophobicity and protection. Reference: "Differential expression of the vegetative and spore-bound hydrophobins of Trichoderma reesei: cloning and characterization of the hfb2 gene." Nakari-Setaelae T., Aro N., Ilmen M., Munoz G., Kalkkinen N., Penttilae M. Eur. J. Biochem. 248:415-423(1997) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.