Se rendre au contenu

ELISA Recombinant Raphanus sativus Defensin-like protein 2(AFP2)

https://biotrend.labm.com/web/image/product.template/151752/image_1920?unique=5e1ca23
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170405 Research areas: Others Target / Protein: AFP2 Biologically active: Not Tested Expression system: E.coli Species of origin: Raphanus sativus (Radish) Delivery time: 3-7 business days Uniprot ID: P30230 AA Sequence: QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC Tag info: N-terminal 6xHis-SUMO-tagged Expression Region: 30-80aa Protein length: FµLl Length MW: 21.7 kDa Alternative Name(s): Cysteine-rich antifungal protein 2 Short name: AFP2 Short name: RAFP2 Relevance: Possesses antifungal activity sensitive to inorganic cations. Induces potential changes in fungal membranes and increased K+ efflux and Ca2+ uptake. Reference: "Mutational analysis of a plant defensin from radish (Raphanus sativus L.) reveals two adjacent sites important for antifungal activity." De Samblanx G.W., Goderis I.J., Thevissen K., Raemaekers R., Fant F., Borremans F., Acland D.P., Osborn R.W., Patel S., Broekaert W.F. J. Biol. Chem. 272:1171-1179(1997). Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

1.066,00 € 1066.0 EUR 1.066,00 €

1.066,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.