Se rendre au contenu

ELISA Recombinant Thermotoga maritima ATP synthase subunit c(atpE)

https://biotrend.labm.com/web/image/product.template/159918/image_1920?unique=b3f4f0f
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) Uniprot NO.:Q9X1V0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MENLGDLAQGLALLGKYLGAGLCMGIGAIGPGIGEGNIGAHAMDAMARQPEMVGTITTRM LLADAVAETTGIYSLLIAFMILLVV Protein Names:Recommended name: ATP synthase subunit c Alternative name(s): ATP synthase F(0) sector subunit c F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein Gene Names:Name:atpE Ordered Locus Names:TM_1615 Expression Region:1-85 Sequence Info:fµLl length protein

1.425,00 € 1425.0 EUR 1.425,00 €

1.425,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables

Our Products !

Check out  !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.