Se rendre au contenu

ELISA Recombinant Olfactory receptor 5M9(OR5M9)

https://biotrend.labm.com/web/image/product.template/136464/image_1920?unique=f2aba11
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q8NGP3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPNFTDVTEFTLLGLTCRQELQVLFFVVFLAVYMITLLGNIGMIILISISPQLQSPMYFF LSHLSFADVCFSSNVTPKmLENLLSETKTISYVGCLVQCYFFIAVVHVEVYILAVMAFDR YMAGCNPLLYGSKMSRTVCVRLISVPYVYGFSVSLICTLWTYGLYFCGNFEINHFYCADP PLIQIACGRVHIKEITMIVIAGINFTYSLSVVLISYTLIVVAVLRMRSADGRRKAFSTCG SHLTAVSMFYGTPIFMYLRRPTEESVEQGKMVAVFYTTVIPmLNPMIYSLRNKDVKEAVN KAITKTYVRQ Protein Names:Recommended name: Olfactory receptor 5M9 Alternative name(s): Olfactory receptor OR11-190 Gene Names:Name:OR5M9 Expression Region:1-310 Sequence Info:fµLl length protein

1.662,00 € 1662.0 EUR 1.662,00 €

1.662,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.