ELISA Recombinant Olfactory receptor 5AR1(OR5AR1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q8NGP9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDKENSSMVTEFIFMGITQDPQMEIIFFVVFLIVYLVNVVGNIGMIILITTDTQLHTPMY FFLCNLSFVDLGYSSAIAPRmLADFLTNHKVISFSSCATQFAFFVGFVDAECYVLAAMAY GRFVAICRPLHYSTFMSKQVCLALmLGSYLAGLVSLVAHTTLTFSLSYCGSNIINHFFCE IPPLLALSCSDTYISEILLFSLCGFIEFSTILIIFISYTFILVAIIRMRSAEGRLKAFST CGSHLTGITLFYGTVMFMYLRPTSSYSLDQDKWASVFYTVIIPmLNPLIYSLRNKDVKAA FKKLIGKKSQ Protein Names:Recommended name: Olfactory receptor 5AR1 Alternative name(s): Olfactory receptor OR11-209 Gene Names:Name:OR5AR1 Expression Region:1-310 Sequence Info:fµLl length protein