ELISA Recombinant Olfactory receptor 4A47(OR4A47)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q6IF82 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEPRKNVTDFVLLGFTQNPKEQKVLFVMFLLFYILTMVGNLLIVVTVTVSETLGSPMYFF LAGLSFIDIIYSSSISPRLISGLFFGNNSISFQSCMAQLFIEHIFGGSEVFLLLVMAYDC YVAICKPLHYLVIMRQWVCVVLLVVSWVGGFLHSVFQLSIIYGLPFCGPNVIDHFFCDMY PLLKLVCTDTHAIGLLVVANGGLACTIVFLLLLISYGVILHSLKNLSQKGRQKALSTCSS HMTVVVFFFVPCIFMYARPARTFPIDKSVSVFYTVITPmLNPLIYTLRNSEMTSAMKKLW RRDLISSST Protein Names:Recommended name: Olfactory receptor 4A47 Alternative name(s): Olfactory receptor OR11-113 Gene Names:Name:OR4A47 Expression Region:1-309 Sequence Info:fµLl length protein