Se rendre au contenu

ELISA Recombinant Prochlorococcus marinus NAD(P)H-quinone oxidoreductase subunit L(ndhL)

https://biotrend.labm.com/web/image/product.template/150560/image_1920?unique=41ec440
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Prochlorococcus marinus (strain NATL2A) Uniprot NO.:Q46LY0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSLISIVCLIPFGLIGAVNPIITLSAYAVLGGMYLLVVPLFLFYWMNNRWNVMGKLERLF IYGLVFLFFPGMILFAPFLNLRMNGKEGS Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit L EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase I subunit L NDH-1 subunit L NDH-L Gene Names:Name:ndhL Ordered Locus Names:PMN2A_0006 Expression Region:1-89 Sequence Info:fµLl length protein

1.429,00 € 1429.0 EUR 1.429,00 €

1.429,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables

Our Products !

Check out  !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.