ELISA Recombinant Bovine UPF0466 protein C22orf32 homolog, mitochondrial

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q2M2S2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:VIVTRSGAILPKPVKMSFGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVPEDDDDDD Protein Names:Recommended name: UPF0466 protein C22orf32 homolog, mitochondrial Gene Names: Expression Region:48-107 Sequence Info:fµLl length protein