Se rendre au contenu

ELISA Recombinant Rickettsia bellii CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase(pgsA)

https://biotrend.labm.com/web/image/product.template/153910/image_1920?unique=e16ca1f
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rickettsia bellii (strain RmL369-C) Uniprot NO.:Q1RKM3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKIDENLPNYLTIARIAAIPVIILTFYINSPLARmLGALLFVLASITDFFDGYIARKYNL VTSFGKmLDPIADKLLVGCVIImLLKKSDVDEIPCLLILAREFLVSGLREFLALVKVSVP VSTLAKTKTFLQMFALSILVLGSKGSNIIYLDLVGEIILWIAAFLTIITGYSYFKACKKY F Protein Names:Recommended name: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase EC= 2.7.8.5 Alternative name(s): Phosphatidylglycerophosphate synthase Short name= PGP synthase Gene Names:Name:pgsA Ordered Locus Names:RBE_0010 Expression Region:1-181 Sequence Info:fµLl length protein

1.526,00 € 1526.0 EUR 1.526,00 €

1.526,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.