ELISA Recombinant Burkholderia xenovorans Disulfide bond formation protein B(dsbB)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Burkholderia xenovorans (strain LB400) Uniprot NO.:Q13V94 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNNDTAmLRRERSLLVLLALICLALVGGALYLQYFLHEDPCPLCIIQRYFFLLIAIFAFL GARFNSWRGVRLLEVLAALSALGGIVTAARHVYVQANPGFSCGFDALQPLVDSLPPAHWL PGVFKVAGLCETAYPPILGLTLPQWSLVAFVIAFIPLALSLVRNRRRIA Protein Names:Recommended name: DisµLfide bond formation protein B Alternative name(s): DisµLfide oxidoreductase Gene Names:Name:dsbB Ordered Locus Names:Bxeno_A3457 ORF Names:Bxe_A0951 Expression Region:1-169 Sequence Info:fµLl length protein