Se rendre au contenu

ELISA Recombinant Alcanivorax borkumensis Alkane 1-monooxygenase 1(alkB1)

https://biotrend.labm.com/web/image/product.template/115951/image_1920?unique=7f7b80c
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Alcanivorax borkumensis (strain SK2 / ATCC 700651 / DSM 11573) Uniprot NO.:Q0VKZ3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSENILTEPPRSDADNEGYVDRKRHLWILSVLWPATPIIGLYLVSQTGWSIWYGLVLILW YGLVPLIDTmLGEDYSNPPESVVPKLEQDRYYKVLTYLTVPIHYAALIISAWWVSTQPIG VFEFLALALSLGIVNGLALNTGHELGHKKETFDRWMAKLVLAVVGYGHFFIEHNKGHHRD VATPMDPATSRMGESIYTFSLREIPGAFKRAWGLEEQRLSRCGKSVWSLDNEVLQPMILT VVLYAALLAFFGPLmLIFLPIQMAFGWWQLTSANYIEHYGLLREKLPNGRYEHQKPHHSW NSNHVMSNLILFHLQRHSDHHAHPTRSYQSLRDFSDLPTLPTGYPGMFFVAFFPSWFRSL MDDRVMEWAHGDINKIQIQPGMREFYEQKFGVKGSESPDTTVAK Protein Names:Recommended name: Alkane 1-monooxygenase 1 EC= 1.14.15.3 Alternative name(s): Alkane hydroxylase Short name= AHs Terminal alkane hydroxylase Gene Names:Name:alkB1 Ordered Locus Names:ABO_2707 Expression Region:1-404 Sequence Info:fµLl length protein

1.761,00 € 1761.0 EUR 1.761,00 €

1.761,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables

Our Products !

Check out  !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.