ELISA Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0540 (AF_0540)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Archaeoglobus fµLgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) Uniprot NO.:O29710 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:GDVVNLTLNEQATVTLDECMYFLDTLQNSSTLPPGEYGIKITHSCLGNEQIEIRTNTTTD VITIKVEKDPNPEESLVEAENEVLSLRKEVQRLEGEVSYYKKLFEVLNKINVDLYDKLQN LATENDELKRELELYKSKAGNYSQLIDELRLELSKMNETVRQLQATNEDLQANLTKIDAE LSRASANLELFQTLFFVTLSFLVGSAFALMRR Protein Names:Recommended name: Uncharacterized protein AF_0540 Gene Names:Ordered Locus Names:AF_0540 Expression Region:17-228 Sequence Info:fµLl length protein