ELISA Recombinant Neosartorya fischeri Protein get1(get1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) (Aspergillus fischerianus) Uniprot NO.:A1CXY5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLSLILTIFFVHVAIYLVNTVGATTIDTLLWILYLKLPTSTSKNAREQSRLKREVVQLKR EMNNTSSQDEFAKWAKLRRKHDKAMDEYEAMNKKLTAQKTSFDWSVKIARWLSTNGLKIF LQFYYSKTPVFALPAGWFPSYVEWVLSFPRAPRGSVSVQVWNSVCATAIAVMAEIVTSmL LQLRSRSASPASTAKAQKAQ Protein Names:Recommended name: Protein get1 Alternative name(s): Guided entry of tail-anchored proteins 1 Gene Names:Name:get1 ORF Names:NFIA_109810 Expression Region:1-200 Sequence Info:fµLl length protein