Se rendre au contenu

ELISA Recombinant Classical swine fever virus Genome polyprotein

https://biotrend.labm.com/web/image/product.template/122548/image_1920?unique=c41145e
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Classical swine fever virus (strain Alfort) (CSFV) (Hog cholera virus) Uniprot NO.:P19712 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SNWVIQEENKQGSLAPLFEELLQQCPPGGQNKTTHMVSAYQLAQGNWVPVSCHVFMGTIP ARRTKTHPYEAYVKLRELVDEHKMKALCGGSGLSKHNEWVIGKVKYQGNLRTKHmLNPGK VAEQLHREGYRHNVYNKTIGSVMTATGIRLEKLPVVRAQTDTTNFHQAIRDKIDKEENLQ TPGLHKKLMEVFNALKRPELEASYDAVDWEELERGINRKGAAGFFERKNIGEVLDSEKNK VEEVIDSLKKGRNIRYYETAIPKNEKRDVNDDWTAGDFVDEKKPRVIQYPEAKTRLAITK VMYKWVKQKPVVIPGYEGKTPLFQIFDKVKKEWDQFQNPVAVSFDTKAWDTQVTTRDLEL IRDIQKFYFKKKWHKFIDTLTKHMSEVPVISADGEVYIRKGQRGSGQPDTSAGNSmLNVL TMVYAFCEATGVPYKSFDRVAKIHVCGDDGFLITERALGEKFASKGVQILYEAGKPQKIT EGDKMKVAYQFDDIEFCSHTPVQVRWSDNTSSYMPGRNTTTILAKMATRLDSSGERGTIA YEKAVAFSFLLMYSWNPLIRRICLLVLSTELQVRPGKSTTYYYEGDPISAYKEVIGHNLF DLKRTSFEKLAKLNLSMSTLGVWTRHTSKRLLQDCVNVGTKEGNWLVNADRLVSSKTGNR YIPGEGHTLQGKHYEELILARKPIGNFEGTDRYNLGPIVNVVLRRLKIMMMALIGRGV Protein Names:Recommended name: Genome polyprotein Cleaved into the following 13 chains: 1. N-terminal protease Short name= 2. N-pro EC= 3. 3.4.22.- Alternative name(s): Autoprotease p20 Capsid protein C E(rns) glycoprotein Alternative Gene Names: Expression Region:3181-3898 Sequence Info:fµLl length protein

2.093,00 € 2093.0 EUR 2.093,00 €

2.093,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.