Se rendre au contenu

ELISA Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 1(PCR1)

https://biotrend.labm.com/web/image/product.template/117038/image_1920?unique=a9584cd
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:Q9LQU2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEAQLHAKPHAQGEWSTGFCDCFSDCRNCCITLCCPCITFGQVAEIVDRGSKSCCAAGAL YmLIDLITSCGRMYACFYSGKMRAQYNIKGDGCTDCLKHFCCNLCALTQQYRELKHRGFD MSLGWAGNAEKQQNQGGVAMGAPAFQGGMTR Protein Names:Recommended name: Protein PLANT CADMIUM RESISTANCE 1 Short name= AtPCR1 Gene Names:Name:PCR1 Ordered Locus Names:At1g14880 ORF Names:F10B6.29 Expression Region:1-151 Sequence Info:fµLl length protein

1.494,00 € 1494.0 EUR 1.494,00 €

1.494,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables

Our Products !

Check out  !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.