Se rendre au contenu

ELISA Recombinant Clostridium difficile Cobalt transport protein CbiM(cbiM)

https://biotrend.labm.com/web/image/product.template/122676/image_1920?unique=c41145e
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Clostridium difficile (strain R20291) Uniprot NO.:C9YID6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MHIMEGYLPVKWSIAWGVIFIPFFLVGLKSIGKIVKQDPKKKVLLALCGAFVFVLSALKI PSVTGSCSHPTGVGLGAIMFGPSVMFVLGTIVLIFQALLLAHGGITTLGANAFSMAIIGP IISFLIFKALKKKDGNNAMPVFLAAAIGDLATYTVTSIQLALAFPDPSGGVMASAIKFLG IFFMTQIPIAIAEGILTVIVYNLITENGEKSILENNDKGVKANEC Protein Names:Recommended name: Cobalt transport protein CbiM Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiM Short name= ECF transporter S component CbiM Gene Names:Name:cbiM Ordered Locus Names:CDR20291_0329 Expression Region:26-250 Sequence Info:fµLl length protein

1.572,00 € 1572.0 EUR 1.572,00 €

1.572,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables

Our Products !

Check out  !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.